PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g046549m
Common NameCISIN_1g046549mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 251aa    MW: 27101.8 Da    PI: 8.5855
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g046549mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-391776362
             zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       +++lkcprC+stntkfCyynny+lsqPr+fCk+CrryWt+GGalrn+P+Ggg+rk+++++
  orange1.1g046549m 17 SEQLKCPRCESTNTKFCYYNNYNLSQPRHFCKNCRRYWTRGGALRNIPIGGGTRKSNTKK 76
                       6899***************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-291175IPR003851Zinc finger, Dof-type
PfamPF027015.9E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1992074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MQDPATFNPM KPHFPESEQL KCPRCESTNT KFCYYNNYNL SQPRHFCKNC RRYWTRGGAL  60
RNIPIGGGTR KSNTKKRQKP DPDPSRSNPT RKSQETANTQ SMLQAAATTS TSSQEPAVTL  120
PGAVARESGT EHDPRRLYGL PLDQDHKMLD ITGSFSSLLA SNGGLGSVLD GITPNGSGFK  180
MVQMGGFGEN FGSDQSLDLI SVRGSGSQNQ GNNNGGESFM QSGNNDSSCW SGGSNGWPDL  240
AIYTPSSNFQ *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.166220.0vegetative meristem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426477.10.0hypothetical protein CICLE_v10026336mg
SwissprotO821551e-43DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A067EU650.0A0A067EU65_CITSI; Uncharacterized protein
TrEMBLV4SGK20.0V4SGK2_9R
STRINGPOPTR_0003s02890.12e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-41DOF zinc finger protein 1